Neuregulin 3 anticorps (Middle Region)

N° du produit ABIN634810

Détail du produit anti-Neuregulin 3 anticorps

Antigène: Neuregulin 3 (NRG3)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Neuregulin 3 est non-conjugé

Application: Western Blotting (WB)

Specificité: NRG3 antibody was raised against the middle region of NRG3

Purification: Affinity purified

Immunogène: NRG3 antibody was raised using the middle region of NRG3 corresponding to a region with amino acids TSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NRG3 Blocking Peptide, catalog no. 33R-9286, is also available for use as a blocking control in assays to test for specificity of this NRG3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRG3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Neuregulin 3

Antigène: Neuregulin 3 (NRG3)

Autre désignation: NRG3 (NRG3 Produits)

Synonymes: anticorps NRG3, anticorps HRG3, anticorps pro-NRG3, anticorps ska, anticorps RGD1559678, anticorps neuregulin 3, anticorps pro-neuregulin-3, membrane-bound isoform, anticorps NRG3, anticorps nrg3, anticorps LOC100478170, anticorps Nrg3

Sujet: Neuregulins are a family of growth and differentiation factors that are related to epidermal growth factor.

Poids moléculaire: 75 kDa (MW of target protein)

Pathways: Signalisation RTK