PODXL anticorps (Middle Region)

N° du produit ABIN634824

Cet anticorps anti-PODXL est un anticorps Lapin Polyclonal détectant PODXL dans WB. Adapté pour Humain.

Aperçu rapide pour PODXL anticorps (Middle Region) (ABIN634824)

Antigène: PODXL (Podocalyxin-Like (PODXL))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PODXL est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PODXL anticorps

Épitope: Middle Region

Specificité: PODXL antibody was raised against the middle region of PODXL

Purification: Affinity purified

Immunogène: PODXL antibody was raised using the middle region of PODXL corresponding to a region with amino acids PATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQ

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PODXL Blocking Peptide, (ABIN5615447), is also available for use as a blocking control in assays to test for specificity of this PODXL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PODXL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PODXL

Antigène: PODXL (Podocalyxin-Like (PODXL))

Autre désignation: PODXL

Sujet: PODXL is a member of the sialomucin protein family. PODXL was originally identified as an important component of glomerular podocytes. Podocytes are highly differentiated epithelial cells with interdigitating foot processes covering the outer aspect of the glomerular basement membrane. Other biological activities of the protein include: binding in a membrane protein complex with Na+/H+ exchanger regulatory factor to intracellular cytoskeletal elements, playing a role in hematopoetic cell differentiation, and being expressed in vascular endothelium cells and binding to L-selectin.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Tube Formation