FMO4 anticorps (N-Term)

N° du produit ABIN634825

Détail du produit anti-FMO4 anticorps

Antigène: FMO4 (Flavin Containing Monooxygenase 4 (FMO4))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FMO4 est non-conjugé

Application: Western Blotting (WB)

Specificité: FMO4 antibody was raised against the N terminal of FMO4

Purification: Affinity purified

Immunogène: FMO4 antibody was raised using the N terminal of FMO4 corresponding to a region with amino acids MVCTGHFLNPHLPLEAFPGIHKFKGQILHSQEYKIPEGFQGKRVLVIGLG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FMO4 Blocking Peptide, catalog no. 33R-6578, is also available for use as a blocking control in assays to test for specificity of this FMO4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FMO4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FMO4

Antigène: FMO4 (Flavin Containing Monooxygenase 4 (FMO4))

Autre désignation: FMO4 (FMO4 Produits)

Synonymes: anticorps FMO2, anticorps D1Ertd532e, anticorps flavin containing monooxygenase 4, anticorps FMO4, anticorps Fmo4

Sujet: FMO4 belongs to the FMO family. Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region.

Poids moléculaire: 63 kDa (MW of target protein)