MUC3B anticorps (N-Term)
-
- Antigène Tous les produits MUC3B
- MUC3B (Mucin 3B, Cell Surface Associated (MUC3B))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MUC3B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MUC3 B antibody was raised against the N terminal of MUC3
- Purification
- Affinity purified
- Immunogène
- MUC3 B antibody was raised using the N terminal of MUC3 corresponding to a region with amino acids MLCADVVETEVGMEVSVDQQFSPDLNDNTSQAYRDFNKTFWNQMQKIFAD
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MUC3B Blocking Peptide, catalog no. 33R-6182, is also available for use as a blocking control in assays to test for specificity of this MUC3B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MUC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MUC3B (Mucin 3B, Cell Surface Associated (MUC3B))
- Autre désignation
- MUC3B (MUC3B Produits)
- Synonymes
- anticorps MUC3, anticorps MUC3A, anticorps MUC3B, anticorps mucin 3B, cell surface associated, anticorps mucin-3B, anticorps MUC3B, anticorps LOC463613
- Sujet
- MUC3B is major glycoprotein component of a variety of mucus gels. It is thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.
- Poids moléculaire
- 35 kDa (MW of target protein)
-