MUC3B anticorps (N-Term)

N° du produit ABIN634921

Détail du produit anti-MUC3B anticorps

Antigène: MUC3B (Mucin 3B, Cell Surface Associated (MUC3B))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MUC3B est non-conjugé

Application: Western Blotting (WB)

Specificité: MUC3 B antibody was raised against the N terminal of MUC3

Purification: Affinity purified

Immunogène: MUC3 B antibody was raised using the N terminal of MUC3 corresponding to a region with amino acids MLCADVVETEVGMEVSVDQQFSPDLNDNTSQAYRDFNKTFWNQMQKIFAD

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MUC3B Blocking Peptide, catalog no. 33R-6182, is also available for use as a blocking control in assays to test for specificity of this MUC3B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MUC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MUC3B

Antigène: MUC3B (Mucin 3B, Cell Surface Associated (MUC3B))

Autre désignation: MUC3B (MUC3B Produits)

Synonymes: anticorps MUC3, anticorps MUC3A, anticorps MUC3B, anticorps mucin 3B, cell surface associated, anticorps mucin-3B, anticorps MUC3B, anticorps LOC463613

Sujet: MUC3B is major glycoprotein component of a variety of mucus gels. It is thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.

Poids moléculaire: 35 kDa (MW of target protein)