Patched 1 anticorps

N° du produit ABIN634927

Cet anticorps Lapin Polyclonal détecte spécifiquement Patched 1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour Patched 1 anticorps (ABIN634927)

Antigène: Patched 1 (PTCH1)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Patched 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Patched 1 anticorps

Purification: Affinity purified

Immunogène: PTCH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PTCH1 Blocking Peptide, (ABIN5615646), is also available for use as a blocking control in assays to test for specificity of this PTCH1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTCH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Patched 1

Antigène: Patched 1 (PTCH1)

Autre désignation: PTCH1

Sujet: PTCH1 is a member of the patched gene family. The protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis. It functions as a tumor suppressor. Mutations of its gene have been associated with nevoid basal cell carcinoma syndrome, esophageal squamous cell carcinoma, trichoepitheliomas, transitional cell carcinomas of the bladder, as well as holoprosencephaly.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: Signalisation Hedgehog, Carbohydrate Homeostasis, Tube Formation