Derlin-3 anticorps (C-Term)
-
- Antigène Voir toutes Derlin-3 (DERL3) Anticorps
- Derlin-3 (DERL3) (Der1-Like Domain Family, Member 3 (DERL3))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Derlin-3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DERL3 antibody was raised against the C terminal of DERL3
- Purification
- Affinity purified
- Immunogène
- DERL3 antibody was raised using the C terminal of DERL3 corresponding to a region with amino acids YYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLP
- Top Product
- Discover our top product DERL3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DERL3 Blocking Peptide, catalog no. 33R-10295, is also available for use as a blocking control in assays to test for specificity of this DERL3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DERL3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Derlin-3 (DERL3) (Der1-Like Domain Family, Member 3 (DERL3))
- Autre désignation
- DERL3 (DERL3 Produits)
- Synonymes
- anticorps 1810006I20Rik, anticorps 1810063P04Rik, anticorps IZP6, anticorps derlin-3, anticorps zgc:63991, anticorps C22orf14, anticorps LLN2, anticorps derlin 3, anticorps Der1-like domain family, member 3, anticorps DERL3, anticorps Derl3, anticorps derl3
- Sujet
- DERL3 belongs to the derlin family, and resides in the endoplasmic reticulum (ER). Proteins that are unfolded or misfolded in the ER must be refolded or degraded to maintain the homeostasis of the ER. This protein appears to be involved in the degradation of misfolded glycoproteins in the ER. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
- Poids moléculaire
- 27 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-