LRRC8A anticorps (N-Term)

N° du produit ABIN634965

Détail du produit anti-LRRC8A anticorps

Antigène: LRRC8A (Leucine Rich Repeat Containing 8 Family, Member A (LRRC8A))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRC8A est non-conjugé

Application: Western Blotting (WB)

Specificité: LRRC8 A antibody was raised against the N terminal of LRRC8

Purification: Affinity purified

Immunogène: LRRC8 A antibody was raised using the N terminal of LRRC8 corresponding to a region with amino acids IPVTELRYFADTQPAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC8A Blocking Peptide, catalog no. 33R-4105, is also available for use as a blocking control in assays to test for specificity of this LRRC8A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRC8A

Antigène: LRRC8A (Leucine Rich Repeat Containing 8 Family, Member A (LRRC8A))

Autre désignation: LRRC8A (LRRC8A Produits)

Synonymes: anticorps AGM5, anticorps LRRC8, anticorps Lrrc8, anticorps mKIAA1437, anticorps wu:fb18g12, anticorps wu:fi21b10, anticorps LLRC8A, anticorps leucine rich repeat containing 8 VRAC subunit A, anticorps leucine rich repeat containing 8A, anticorps leucine rich repeat containing 8 VRAC subunit Aa, anticorps leucine-rich repeat containing 8 family member A S homeolog, anticorps leucine rich repeat containing 8 family member A, anticorps LRRC8A, anticorps Lrrc8a, anticorps lrrc8aa, anticorps lrrc8a.S

Sujet: LRRC8A is a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions. LRRC8A is a putative four-pass transmembrane protein that plays a role in B cell development. Defects in this gene cause autosomal dominant non-Bruton type agammaglobulinemia, an immunodeficiency disease resulting from defects in B cell maturation.

Poids moléculaire: 94 kDa (MW of target protein)