MFN2 anticorps (C-Term)
-
- Antigène Voir toutes MFN2 Anticorps
- MFN2 (Mitofusin 2 (MFN2))
-
Épitope
- C-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MFN2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Mitofusin 2 antibody was raised against the C terminal of MFN2
- Purification
- Affinity purified
- Immunogène
- Mitofusin 2 antibody was raised using the C terminal of MFN2 corresponding to a region with amino acids LEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
- Top Product
- Discover our top product MFN2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Mitofusin 2 Blocking Peptide, catalog no. 33R-4923, is also available for use as a blocking control in assays to test for specificity of this Mitofusin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MFN2 (Mitofusin 2 (MFN2))
- Autre désignation
- Mitofusin 2 (MFN2 Produits)
- Synonymes
- anticorps CG3869, anticorps Dmel\\CG3869, anticorps MARF, anticorps Marf-1, anticorps Mfn, anticorps anon-WO0125274.3, anticorps dMFN, anticorps dMfn, anticorps dmfn, anticorps marf, anticorps mfn, anticorps mfn2, anticorps MFN2, anticorps hsg, anticorps cmt2a, anticorps cprp1, anticorps cmt2a2, anticorps CMT2A, anticorps CMT2A2, anticorps CPRP1, anticorps HSG, anticorps D630023P19Rik, anticorps Fzo, anticorps mg:cb01g09, anticorps si:dkeyp-104h9.2, anticorps wu:fb79a11, anticorps mitofusin 2, anticorps Mitochondrial assembly regulatory factor, anticorps mitofusin-2, anticorps mitofusin 2 L homeolog, anticorps MFN2, anticorps Marf, anticorps mfn2, anticorps LOC100186475, anticorps Mfn2, anticorps mfn2.L
- Sujet
- MFN2 is a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. It is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke.
- Poids moléculaire
- 86 kDa (MW of target protein)
- Pathways
- Skeletal Muscle Fiber Development
-