ALDH6A1 anticorps (Middle Region)
-
- Antigène Voir toutes ALDH6A1 Anticorps
- ALDH6A1 (Aldehyde Dehydrogenase 6 Family, Member A1 (ALDH6A1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ALDH6A1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ALDH6 A1 antibody was raised against the middle region of ALDH6 1
- Purification
- Affinity purified
- Immunogène
- ALDH6 A1 antibody was raised using the middle region of ALDH6 1 corresponding to a region with amino acids GQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQW
- Top Product
- Discover our top product ALDH6A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ALDH6A1 Blocking Peptide, catalog no. 33R-3518, is also available for use as a blocking control in assays to test for specificity of this ALDH6A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ALDH6A1 (Aldehyde Dehydrogenase 6 Family, Member A1 (ALDH6A1))
- Autre désignation
- ALDH6A1 (ALDH6A1 Produits)
- Synonymes
- anticorps MMSADHA, anticorps MMSDH, anticorps Mmsdh, anticorps cb850, anticorps wu:fb03a04, anticorps zgc:92082, anticorps 1110038I05Rik, anticorps AI314632, anticorps aldehyde dehydrogenase 6 family member A1, anticorps aldehyde dehydrogenase 6 family, member A1, anticorps aldehyde dehydrogenase 6 family member A1 L homeolog, anticorps methylmalonic acid semialdehyde dehydrogenase, anticorps methylmalonate-semialdehyde dehydrogenase (CoA acylating), anticorps aldehyde dehydrogenase family 6, subfamily A1, anticorps ALDH6A1, anticorps Aldh6a1, anticorps aldh6a1.L, anticorps CCNA_02357, anticorps aldh6a1, anticorps VAA_RS07845
- Sujet
- ALDH6A1 plays a role in valine and pyrimidine metabolism. ALDH6A1 binds fatty acyl-CoA. This protein belongs to the aldehyde dehydrogenases family of proteins. This enzyme plays a role in the valine and pyrimidine catabolic pathways.
- Poids moléculaire
- 54 kDa (MW of target protein)
- Pathways
- Brown Fat Cell Differentiation
-