ALDH6A1 anticorps (Middle Region)

N° du produit ABIN635061

Cet anticorps anti-ALDH6A1 Polyclonal Lapin (ABIN635061) détecte spécifiquement ALDH6A1 dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour ALDH6A1 anticorps (Middle Region) (ABIN635061)

Antigène: ALDH6A1 (Aldehyde Dehydrogenase 6 Family, Member A1 (ALDH6A1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALDH6A1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ALDH6A1 anticorps

Épitope: Middle Region

Specificité: ALDH6 A1 antibody was raised against the middle region of ALDH6 1

Purification: Affinity purified

Immunogène: ALDH6 A1 antibody was raised using the middle region of ALDH6 1 corresponding to a region with amino acids GQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALDH6A1 Blocking Peptide, (ABIN938904), is also available for use as a blocking control in assays to test for specificity of this ALDH6A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALDH6A1

Antigène: ALDH6A1 (Aldehyde Dehydrogenase 6 Family, Member A1 (ALDH6A1))

Autre désignation: ALDH6A1

Sujet: ALDH6A1 plays a role in valine and pyrimidine metabolism. ALDH6A1 binds fatty acyl-CoA. This protein belongs to the aldehyde dehydrogenases family of proteins. This enzyme plays a role in the valine and pyrimidine catabolic pathways.

Poids moléculaire: 54 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation