ALDH6A1 anticorps (Middle Region)

N° du produit ABIN635062

Cet anticorps Lapin Polyclonal détecte spécifiquement ALDH6A1 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour ALDH6A1 anticorps (Middle Region) (ABIN635062)

Antigène: ALDH6A1 (Aldehyde Dehydrogenase 6 Family, Member A1 (ALDH6A1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALDH6A1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ALDH6A1 anticorps

Épitope: Middle Region

Specificité: ALDH6 A1 antibody was raised against the middle region of ALDH6 1

Purification: Affinity purified

Immunogène: ALDH6 A1 antibody was raised using the middle region of ALDH6 1 corresponding to a region with amino acids AVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLID

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALDH6A1 Blocking Peptide, (ABIN936992), is also available for use as a blocking control in assays to test for specificity of this ALDH6A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALDH6A1

Antigène: ALDH6A1 (Aldehyde Dehydrogenase 6 Family, Member A1 (ALDH6A1))

Autre désignation: ALDH6A1

Sujet: This protein belongs to the aldehyde dehydrogenases family of proteins. This enzyme plays a role in the valine and pyrimidine catabolic pathways.

Poids moléculaire: 54 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation