Acsl3 anticorps (N-Term)

N° du produit ABIN635143

Cet anticorps Lapin Polyclonal détecte spécifiquement Acsl3 dans WB. Il présente une réactivité envers Humain et Souris.

Aperçu rapide pour Acsl3 anticorps (N-Term) (ABIN635143)

Antigène: Acsl3 (Acyl-CoA Synthetase Long-Chain Family Member 3 (Acsl3))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Acsl3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Acsl3 anticorps

Épitope: N-Term

Specificité: ACSL3 antibody was raised against the N terminal of ACSL3

Purification: Affinity purified

Immunogène: ACSL3 antibody was raised using the N terminal of ACSL3 corresponding to a region with amino acids LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACSL3 Blocking Peptide, (ABIN940231), is also available for use as a blocking control in assays to test for specificity of this ACSL3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Acsl3

Antigène: Acsl3 (Acyl-CoA Synthetase Long-Chain Family Member 3 (Acsl3))

Autre désignation: ACSL3

Sujet: ACSL3 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates.

Poids moléculaire: 80 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome