Acsl3 anticorps (N-Term)

N° du produit ABIN635143

Détail du produit anti-Acsl3 anticorps

Antigène: Acsl3 (Acyl-CoA Synthetase Long-Chain Family Member 3 (Acsl3))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Acsl3 est non-conjugé

Application: Western Blotting (WB)

Specificité: ACSL3 antibody was raised against the N terminal of ACSL3

Purification: Affinity purified

Immunogène: ACSL3 antibody was raised using the N terminal of ACSL3 corresponding to a region with amino acids LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACSL3 Blocking Peptide, catalog no. 33R-4845, is also available for use as a blocking control in assays to test for specificity of this ACSL3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Acsl3

Antigène: Acsl3 (Acyl-CoA Synthetase Long-Chain Family Member 3 (Acsl3))

Autre désignation: ACSL3 (Acsl3 Produits)

Synonymes: anticorps ACSL3, anticorps acsl3, anticorps fa07a08, anticorps im:7155129, anticorps si:dkey-20f20.5, anticorps wu:fa07a08, anticorps wu:fb34c03, anticorps si:dkeyp-109h9.2, anticorps ACS3, anticorps FACL3, anticorps PRO2194, anticorps 2610510B12Rik, anticorps Acs3, anticorps C85929, anticorps Facl3, anticorps Pro2194, anticorps F15H21.7, anticorps F15H21_7, anticorps long-chain acyl-CoA synthetase 3, anticorps acyl-CoA synthetase long-chain family member 3, anticorps acyl-CoA synthetase long chain family member 3, anticorps acyl-CoA synthetase long chain family member 3b, anticorps acyl-CoA synthetase long chain family member 3a, anticorps AcsL3, anticorps AMP-dependent synthetase and ligase family protein, anticorps ACSL3, anticorps acsl3b, anticorps acsl3a, anticorps acsL3, anticorps acsl3, anticorps Acsl3, anticorps LACS3

Sujet: ACSL3 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates.

Poids moléculaire: 80 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome