HGF anticorps

N° du produit ABIN635210

L’anticorps anti-HGF Polyclonal Lapin est utilisé pour la détection de HGF dans des échantillons de Humain, Rat, Souris et Chien. Il a été validé pour WB.

Aperçu rapide pour HGF anticorps (ABIN635210)

Antigène: HGF (Hepatocyte Growth Factor (Hepapoietin A, Scatter Factor) (HGF))

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HGF est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HGF anticorps

Purification: Affinity purified

Immunogène: HGF antibody was raised using a synthetic peptide corresponding to a region with amino acids VKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HGF Blocking Peptide, (ABIN5614000), is also available for use as a blocking control in assays to test for specificity of this HGF antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HGF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HGF

Antigène: HGF (Hepatocyte Growth Factor (Hepapoietin A, Scatter Factor) (HGF))

Autre désignation: HGF

Sujet: Hepatocyte growth factor regulates cell growth, cell motility, and morphogenesis by activating a tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. Hepatocyte growth factor is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability to stimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis, and tissue regeneration.

Poids moléculaire: 79 kDa (MW of target protein)

Pathways: Signalisation RTK, Carbohydrate Homeostasis, Glycosaminoglycan Metabolic Process, Synaptic Membrane, Signaling of Hepatocyte Growth Factor Receptor