Golgin B1 (GOLGB1) (N-Term) anticorps

N° du produit ABIN635428

Cet anticorps Lapin Polyclonal détecte spécifiquement dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour Golgin B1 (GOLGB1) (N-Term) anticorps (ABIN635428)

Antigène: Golgin B1 (GOLGB1)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Détail du produit

Épitope: N-Term

Specificité: GOLGB1 antibody was raised against the N terminal of GOLGB1

Purification: Affinity purified

Immunogène: GOLGB1 antibody was raised using the N terminal of GOLGB1 corresponding to a region with amino acids NKYIEEMKAQGGTVLPTEPQSEEQLSKHDKSSTEEEMEIEKIKHKLQEKE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GOLGB1 Blocking Peptide, (ABIN5613819), is also available for use as a blocking control in assays to test for specificity of this GOLGB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOLGB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Golgin B1 (GOLGB1)

Autre désignation: GOLGB1

Sujet: GOLGB1 may participate in forming intercisternal cross-bridges of the Golgi complex.

Poids moléculaire: 376 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome