Golgin B1 (GOLGB1) (N-Term) anticorps

N° du produit ABIN635428

Détail du produit

Antigène: Golgin B1 (GOLGB1)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: GOLGB1 antibody was raised against the N terminal of GOLGB1

Purification: Affinity purified

Immunogène: GOLGB1 antibody was raised using the N terminal of GOLGB1 corresponding to a region with amino acids NKYIEEMKAQGGTVLPTEPQSEEQLSKHDKSSTEEEMEIEKIKHKLQEKE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GOLGB1 Blocking Peptide, catalog no. 33R-6750, is also available for use as a blocking control in assays to test for specificity of this GOLGB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOLGB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Golgin B1 (GOLGB1)

Autre désignation: GOLGB1 (GOLGB1 Produits)

Synonymes: anticorps gcp, anticorps golim1, anticorps giantin, anticorps 4930428L02Rik, anticorps 628101, anticorps 6330407A06Rik, anticorps AU042952, anticorps C130074L01Rik, anticorps F730017E11Rik, anticorps Gm6840, anticorps mKIAA4151, anticorps GCP, anticorps GCP372, anticorps GOLIM1, anticorps golgin B1, anticorps golgin B1 S homeolog, anticorps golgi autoantigen, golgin subfamily b, macrogolgin 1, anticorps GOLGB1, anticorps golgb1.S, anticorps Golgb1

Sujet: GOLGB1 may participate in forming intercisternal cross-bridges of the Golgi complex.

Poids moléculaire: 376 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome