EDEM1 anticorps (N-Term)

N° du produit ABIN635444

L’anticorps Lapin Polyclonal anti-EDEM1 a été validé pour WB. Il convient pour détecter EDEM1 dans des échantillons de Humain et Souris.

Aperçu rapide pour EDEM1 anticorps (N-Term) (ABIN635444)

Antigène: EDEM1 (ER Degradation Enhancer, Mannosidase alpha-Like 1 (EDEM1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EDEM1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-EDEM1 anticorps

Épitope: N-Term

Specificité: EDEM1 antibody was raised against the N terminal of EDEM1

Purification: Affinity purified

Immunogène: EDEM1 antibody was raised using the N terminal of EDEM1 corresponding to a region with amino acids MAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EDEM1 Blocking Peptide, (ABIN5613302), is also available for use as a blocking control in assays to test for specificity of this EDEM1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EDEM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EDEM1

Antigène: EDEM1 (ER Degradation Enhancer, Mannosidase alpha-Like 1 (EDEM1))

Autre désignation: EDEM1

Sujet: EDEM1 belongs to the glycosyl hydrolase 47 family. It extracts misfolded glycoproteins, but not glycoproteins undergoing productive folding, from the calnexin cycle. It is directly involved in endoplasmic reticulum-associated degradation (ERAD) and targets misfolded glycoproteins for degradation in an N-glycan-dependent manner.

Poids moléculaire: 74 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling