Sonic Hedgehog anticorps

N° du produit ABIN635696

L’anticorps Lapin Polyclonal anti-Sonic Hedgehog a été validé pour WB et IHC. Il convient pour détecter Sonic Hedgehog dans des échantillons de Humain, Souris, Poisson zèbre (Danio rerio) et Chien.

Aperçu rapide pour Sonic Hedgehog anticorps (ABIN635696)

Antigène: Sonic Hedgehog (SHH)

Reactivité: Humain, Souris, Poisson zèbre (Danio rerio), Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Sonic Hedgehog est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-Sonic Hedgehog anticorps

Purification: Affinity purified

Immunogène: Sonic Hedgehog antibody was raised using a synthetic peptide corresponding to a region with amino acids RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Sonic Hedgehog Blocking Peptide, (ABIN5616338), is also available for use as a blocking control in assays to test for specificity of this Sonic Hedgehog antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Sonic Hedgehog

Antigène: Sonic Hedgehog (SHH)

Autre désignation: Sonic Hedgehog

Sujet: SHH is a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE). It is also thought that mutations in its gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Signalisation Hedgehog, Dopaminergic Neurogenesis, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development