LCAT anticorps (C-Term)

N° du produit ABIN635780

Détail du produit anti-LCAT anticorps

Antigène: LCAT (Lecithin-Cholesterol Acyltransferase (LCAT))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LCAT est non-conjugé

Application: Western Blotting (WB)

Specificité: LCAT antibody was raised against the C terminal of LCAT

Purification: Affinity purified

Immunogène: LCAT antibody was raised using the C terminal of LCAT corresponding to a region with amino acids GVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LCAT Blocking Peptide, catalog no. 33R-3643, is also available for use as a blocking control in assays to test for specificity of this LCAT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LCAT

Antigène: LCAT (Lecithin-Cholesterol Acyltransferase (LCAT))

Autre désignation: LCAT (LCAT Produits)

Synonymes: anticorps AI046659, anticorps D8Wsu61e, anticorps MGC82035, anticorps lcat, anticorps MGC88964, anticorps LCAT, anticorps lecithin-cholesterol acyltransferase, anticorps lecithin cholesterol acyltransferase, anticorps lecithin-cholesterol acyltransferase L homeolog, anticorps solute carrier family 12 member 4, anticorps fragile site, aphidicolin type, common, fra(13)(q13.2), anticorps LCAT, anticorps Lcat, anticorps lcat.L, anticorps lcat, anticorps SLC12A4, anticorps FRA13A

Sujet: LCAT is an extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in its gene have been found to cause fish-eye disease as well as LCAT deficiency.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Lipid Metabolism