IL11RA anticorps (Middle Region)

N° du produit ABIN635795

Détail du produit anti-IL11RA anticorps

Antigène: IL11RA (Interleukin 11 Receptor, alpha (IL11RA))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IL11RA est non-conjugé

Application: Western Blotting (WB)

Specificité: IL11 R alpha antibody was raised against the middle region of IL11 A

Purification: Affinity purified

Immunogène: IL11 R alpha antibody was raised using the middle region of IL11 A corresponding to a region with amino acids FLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IL11R alpha Blocking Peptide, catalog no. 33R-2968, is also available for use as a blocking control in assays to test for specificity of this IL11R alpha antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 A antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IL11RA

Antigène: IL11RA (Interleukin 11 Receptor, alpha (IL11RA))

Autre désignation: IL11R alpha (IL11RA Produits)

Synonymes: anticorps CRSDA, anticorps fi26e06, anticorps il-11ra, anticorps wu:fi26e06, anticorps AI314697, anticorps GP130, anticorps Il-11ra, anticorps Il11ra, anticorps Il11ra2, anticorps NR1, anticorps interleukin 11 receptor subunit alpha, anticorps interleukin 11 receptor, alpha, anticorps interleukin 11 receptor subunit alpha 1, anticorps interleukin 11 receptor, alpha chain 1, anticorps IL11RA, anticorps il11ra, anticorps Il11ra1, anticorps Il11ra

Sujet: Interleukin 11 is a stromal cell-derived cytokine that belongs to a family of pleiotropic and redundant cytokines that use the gp130 transducing subunit in their high affinity receptors. IL11RA is the IL-11 receptor, which is a member of the hematopoietic cytokine receptor family. This particular receptor is very similar to ciliary neurotrophic factor, since both contain an extracellular region with a 2-domain structure composed of an immunoglobulin-like domain and a cytokine receptor-like domain.

Poids moléculaire: 43 kDa (MW of target protein)

Pathways: Signalistation JAK/STAT, Growth Factor Binding