IL11RA anticorps (N-Term)

N° du produit ABIN635796

Détail du produit anti-IL11RA anticorps

Antigène: IL11RA (Interleukin 11 Receptor, alpha (IL11RA))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IL11RA est non-conjugé

Application: Western Blotting (WB)

Specificité: IL11 R alpha antibody was raised against the N terminal of IL11 A

Purification: Affinity purified

Immunogène: IL11 R alpha antibody was raised using the N terminal of IL11 A corresponding to a region with amino acids QLGYPPARPVVSCQAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGAD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IL11R alpha Blocking Peptide, catalog no. 33R-7626, is also available for use as a blocking control in assays to test for specificity of this IL11R alpha antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 A antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IL11RA

Antigène: IL11RA (Interleukin 11 Receptor, alpha (IL11RA))

Autre désignation: IL11R alpha (IL11RA Produits)

Sujet: Interleukin 11 is a stromal cell-derived cytokine that belongs to a family of pleiotropic and redundant cytokines that use the gp130 transducing subunit in their high affinity receptors. IL11RA is the IL-11 receptor, which is a member of the hematopoietic cytokine receptor family. This particular receptor is very similar to ciliary neurotrophic factor, since both contain an extracellular region with a 2-domain structure composed of an immunoglobulin-like domain and a cytokine receptor-like domain.

Poids moléculaire: 43 kDa (MW of target protein)

Pathways: Signalistation JAK/STAT, Growth Factor Binding