FZD7 anticorps

N° du produit ABIN635842

Cet anticorps Lapin Polyclonal détecte spécifiquement FZD7 dans WB et IHC. Il présente une réactivité envers Humain, Souris et Chien.

Aperçu rapide pour FZD7 anticorps (ABIN635842)

Antigène: FZD7 (Frizzled Family Receptor 7 (FZD7))

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FZD7 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-FZD7 anticorps

Purification: Affinity purified

Immunogène: FZD7 antibody was raised using a synthetic peptide corresponding to a region with amino acids PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FZD7 Blocking Peptide, (ABIN5613675), is also available for use as a blocking control in assays to test for specificity of this FZD7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FZD7

Antigène: FZD7 (Frizzled Family Receptor 7 (FZD7))

Autre désignation: FZD7

Sujet: FZD7 is 7-transmembrane domain protein that is receptor for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif.

Poids moléculaire: 63 kDa (MW of target protein)

Pathways: Signalisation WNT, Stem Cell Maintenance