DLK1 anticorps

N° du produit ABIN635854

Détail du produit anti-DLK1 anticorps

Antigène: DLK1 (delta-Like 1 Homolog (Drosophila) (DLK1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DLK1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DLK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DLK1 Blocking Peptide, catalog no. 33R-8692, is also available for use as a blocking control in assays to test for specificity of this DLK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DLK1

Antigène: DLK1 (delta-Like 1 Homolog (Drosophila) (DLK1))

Autre désignation: DLK1 (DLK1 Produits)

Synonymes: anticorps DELTA1, anticorps DL1, anticorps Delta, anticorps DLK, anticorps DLK-1, anticorps Delta1, anticorps FA1, anticorps PREF1, anticorps Pref-1, anticorps ZOG, anticorps pG2, anticorps AW742678, anticorps DlkI, anticorps Ly107, anticorps Peg9, anticorps SCP1, anticorps pref-1, anticorps Zog, anticorps delta like canonical Notch ligand 1, anticorps delta like non-canonical Notch ligand 1, anticorps delta-like 1 homolog (Drosophila), anticorps delta-like 1 (Drosophila), anticorps DLL1, anticorps DLK1, anticorps Dll1, anticorps Dlk1

Sujet: DLK1 may have a role in neuroendocrine differentiation.

Poids moléculaire: 41 kDa (MW of target protein)