APOB anticorps (Middle Region)

N° du produit ABIN636056

Détail du produit anti-APOB anticorps

Antigène: APOB (Apolipoprotein B (APOB))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp APOB est non-conjugé

Application: Western Blotting (WB)

Specificité: ApoB antibody was raised against the middle region of APOB

Purification: Affinity purified

Immunogène: ApoB antibody was raised using the middle region of APOB corresponding to a region with amino acids SPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ApoB Blocking Peptide, catalog no. 33R-8668, is also available for use as a blocking control in assays to test for specificity of this ApoB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur APOB

Antigène: APOB (Apolipoprotein B (APOB))

Autre désignation: ApoB (APOB Produits)

Synonymes: anticorps FLDB, anticorps LDLCQ4, anticorps Ac1-060, anticorps Apo B-100, anticorps ApoB-100, anticorps ApoB-48, anticorps AI315052, anticorps apob-100, anticorps apob-48, anticorps APOB-100, anticorps ApoB(100), anticorps APOB, anticorps apolipoprotein B, anticorps APOB, anticorps Apob

Sujet: This gene product is the main apolipoprotein of chylomicrons and low density lipoproteins. It occurs in plasma as two main isoforms, apoB-48 and apoB-100: the former is synthesized exclusively in the gut and the latter in the liver.

Poids moléculaire: 241 kDa (MW of target protein)

Pathways: Lipid Metabolism