PPT1 anticorps (C-Term)

N° du produit ABIN6719501

Détail du produit anti-PPT1 anticorps

Antigène: PPT1 (Palmitoyl-Protein Thioesterase 1 (PPT1))

Épitope: AA 191-224, C-Term

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp PPT1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Fonction: Mouse IgG monoclonal antibody for PPT1 detection. Tested with WB, IHC-P, FCM in Human.

Séquence: KEDVYRNHSI FLADINQERG INESYKKNLM ALKK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Mouse IgG monoclonal antibody for PPT1 detection. Tested with WB, IHC-P, FCM in Human.

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human PPT1 (191-224aa KEDVYRNHSIFLADINQERGINESYKKNLMALKK), different from the related mouse and rat sequences by four amino acids.

Clone: 10F3

Isotype: IgG

Information d'application

Indications d'application:

Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL Flow Cytometry|1-3 μg/1x106 cells

Commentaires:

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur PPT1

Antigène: PPT1 (Palmitoyl-Protein Thioesterase 1 (PPT1))

Autre désignation: PPT1 (PPT1 Produits)

Synonymes: anticorps CLN1, anticorps INCL, anticorps PPT, anticorps 9530043G02Rik, anticorps AA960502, anticorps C77813, anticorps D4Ertd184e, anticorps Ppt, anticorps wu:fj17f04, anticorps zgc:63969, anticorps PPT-1, anticorps ppt1, anticorps palmitoyl-protein thioesterase 1, anticorps Palmitoyl-protein thioesterase 1, anticorps palmitoyl-protein thioesterase 1 (ceroid-lipofuscinosis, neuronal 1, infantile), anticorps palmitoyl-protein thioesterase 1 L homeolog, anticorps PPT1, anticorps MGYG_00692, anticorps Ppt1, anticorps ppt-1, anticorps ppt1, anticorps ppt1.L

Sujet:

Synonyms: Palmitoyl-protein thioesterase 1, PPT-1, Palmitoyl-protein hydrolase 1, PPT1, CLN1, PPT

Background: Palmitoyl-protein thioesterase 1 (PPT-1), also known as palmitoyl-protein hydrolase 1, is an enzyme that in humans is encoded by the PPT1 gene. PPT-1 is a member of the palmitoyl protein thioesterase family. The protein encoded by this gene is a small glycoprotein involved in the catabolism of lipid-modified proteins during lysosomal degradation. The encoded enzyme removes thioester-linked fatty acyl groups such as palmitate from cysteine residues. Defects in this gene are a cause of infantile neuronal ceroid lipofuscinosis 1 (CLN1, or INCL) and neuronal ceroid lipofuscinosis 4 (CLN4). Two transcript variants encoding different isoforms have been found for this gene.

ID gène: 5538

UniProt: P50897

Pathways: SARS-CoV-2 Protein Interactome