MAP3K1 anticorps (AA 1077-1176)

N° du produit ABIN6937805

Cet anticorps Souris Monoclonal détecte spécifiquement MAP3K1 dans WB et IHC (f). Il présente une réactivité envers Humain.

Aperçu rapide pour MAP3K1 anticorps (AA 1077-1176) (ABIN6937805)

Antigène: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp MAP3K1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Formalin-fixed Sections) (IHC (f))

Clone: 2F6

Détail du produit anti-MAP3K1 anticorps

Épitope: AA 1077-1176

Specificité: Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NFB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.

Réactivité croisée (Details): Human.

Purification: 1.0mg/ml of Ab purified from Bioreactor by Protein A/G.

Immunogène: Partial recombinant MAP3K1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)

Isotype: IgG2a kappa

Information d'application

Indications d'application:

Known_Application: Western Blot (1-2 μg/mL),Immunohistochemistry (Formalin-fixed) (1-2 μg/mL for 30 minutes at RT)(Staining of formalin-fixed tissues requires heating tissue sections in 10 mM Tris Buffer with 1 mM EDTA, pH 9.0, for 45 min at 95°C followed by cooling at RT for 20 minutes)Optimal dilution for a specific application should be determined.

Positive_Control: A431, HeLa or HL-60 cells. Liver tissue.

Restrictions: For Research Use only

Stockage

Concentration: 1.0 mg/mL

Buffer: Prepared in 10 mM PBS, WITHOUT BSA and Azide.

Agent conservateur: Azide free

Stock: -20 °C,-80 °C

Stockage commentaire: Antibody without azide store at -20 to -80 °C. Antibody is stable for 24 months. Non-hazardous.

Date de péremption: 24 months

Détails sur MAP3K1

Antigène: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))

Autre désignation: MAP3K1

Sujet: MEKK1, MEK Kinase 1, MEKK, SRXY6, MAPKKK1,MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1)
Cellular localisation: Cytoplasmic

Poids moléculaire: 195kDa (intact), 80kDa (cleaved)

ID gène: 4214, 653654

UniProt: Q13233

Pathways: Signalisation MAPK, Interferon-gamma Pathway, Caspase Cascade in Apoptosis, Signalisation TLR, Fc-epsilon Receptor Signaling Pathway, Activation of Innate immune Response, Regulation of Actin Filament Polymerization, Toll-Like Receptors Cascades