CD4 anticorps (AA 412-458)

N° du produit ABIN7538099

Cet anticorps Lapin Polyclonal détecte spécifiquement CD4 dans WB et ELISA. Il présente une réactivité envers Humain.

Aperçu rapide pour CD4 anticorps (AA 412-458) (ABIN7538099)

Antigène: CD4

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CD4 est non-conjugé

Application: Western Blotting (WB), ELISA

Détail du produit anti-CD4 anticorps

Épitope: AA 412-458

Fonction: Rabbit polyclonal antibodies to CD4

Specificité: CD4 full length protein

Réactivité croisée (Details): May cross-react with other species

Purification: Immunogen affinity column

Immunogène: IGLGIFFCVRCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI - alphaalpha 412-458

Isotype: IgG, IgM

Information d'application

Indications d'application: Western blot: 0.1-1.0 μg/mL

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: Glycine pH 7.2

Stock: 4 °C,-80 °C

Stockage commentaire: Short term up to 1 month at 2-8°C, long term can be held for up to five years at -70°C

Détails sur CD4

Antigène: CD4

Autre désignation: CD4

Sujet: Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class II molecule:peptide complex. The antigens presented by class II peptides are derived from extracellular proteins while class I peptides are derived from cytosolic proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class II presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of T-helper cells. In other cells such as macrophages or NK cells, plays a role in differentiation/activation, cytokine expression and cell migration in a TCR/LCK-independent pathway. Participates in the development of T-helper cells in the thymus and triggers the differentiation of monocytes into functional mature macrophages

Poids moléculaire: 51111 Da

ID gène: 920

NCBI Accession: NP_000607

UniProt: P01730

Pathways: TCR Signaling, Maintenance of Protein Location, CXCR4-mediated Signaling Events