MAP3K1 anticorps (AA 1077-1176) (Biotin)

N° du produit ABIN7657213

Cet anticorps Souris Monoclonal détecte spécifiquement MAP3K1 dans IHC et IHC (fp). Il présente une réactivité envers Humain.

Aperçu rapide pour MAP3K1 anticorps (AA 1077-1176) (Biotin) (ABIN7657213)

Antigène: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp MAP3K1 est conjugé à/à la Biotin

Application: Immunohistochemistry (IHC), Immunohistochemistry (Formalin-fixed Paraffin-embedded Sections) (IHC (fp))

Clone: 2F6

Détail du produit anti-MAP3K1 anticorps (Biotin)

Épitope: AA 1077-1176

Fonction: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1)(2F6), Biotin conjugate

Attributs du produit: Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NFB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.

Immunogène: Partial recombinant MAP3K1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)

Isotype: IgG2a, kappa

Information d'application

Indications d'application: Higher concentration may be required for direct detection using primary antibody conjugates than for indirect detection with secondary antibody. Immunohistochemistry (formalin-fixed): 1-2 μg/mL for 30 minutes at RT. Staining of formalin-fixed tissues requires boiling tissue sections in 10 mM Tris buffer with 1 mM EDTA pH 9.0 for 10-20 minutes followed by cooling at RT for 20 minutes. Western Blot 0.5-1 μg/mL. Optimal dilution for a specific application should be determined by user

Commentaires:

Positive Control: A431, HeLa or HL-60 cells. Liver tissue.

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 0.1 mg/mL

Buffer: PBS, 0.1 % BSA, 0.05 % azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C

Stockage commentaire:

Stable at room temperature or 37°C for 7 days.

Store at 2 to 8°C. Protect fluorescent conjugates from light

Date de péremption: 24 months

Détails sur MAP3K1

Antigène: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))

Autre désignation: MAP3K1

Sujet:

Synonyms: MEKK1, MEK Kinase 1, MEKK, SRXY6, MAPKKK1

Gene Symbol: MAP3K1

Poids moléculaire: 195 kDa (intact), 80 kDa (cleaved)

ID gène: 4214

UniProt: Q13233

Pathways: Signalisation MAPK, Interferon-gamma Pathway, Caspase Cascade in Apoptosis, Signalisation TLR, Fc-epsilon Receptor Signaling Pathway, Activation of Innate immune Response, Regulation of Actin Filament Polymerization, Toll-Like Receptors Cascades