14-3-3 zeta anticorps

N° du produit ABIN7879845

L’anticorps anti-14-3-3 zeta Monoclonal Souris est utilisé pour la détection de 14-3-3 zeta dans des échantillons de Humain, Souris, Rat et Singe. Il a été validé pour WB et FACS.

Aperçu rapide pour 14-3-3 zeta anticorps (ABIN7879845)

Antigène: 14-3-3 zeta (YWHAZ)

Reactivité: Humain, Souris, Rat, Singe

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp 14-3-3 zeta est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS)

Clone: 6G5

Détail du produit anti-14-3-3 zeta anticorps

Fonction: YWHAZ Antibody / 14-3-3 zeta/delta

Séquence: LLEKFLIPNA SQAESKVFYL KMKGDYYRYL AEVAAGDDKK GIVDQ

Purification: Affinity purified

Immunogène: Amino acids LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ from the human protein were used as the immunogen for the YWHAZ antibody.

Isotype: IgG2b

Information d'application

Indications d'application: Optimal dilution of the YWHAZ antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the YWHAZ antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur 14-3-3 zeta

Antigène: 14-3-3 zeta (YWHAZ)

Autre désignation: YWHAZ

Sujet: 14-3-3 protein zeta/delta is a protein that in humans is encoded by the YWHAZ gene on chromosome 8. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99 % identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.

UniProt: P63104

Pathways: Apoptose, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location