ALKBH1 anticorps

N° du produit ABIN7879953

L’anticorps anti-ALKBH1 Polyclonal Lapin est utilisé pour la détection de ALKBH1 dans des échantillons de Humain. Il a été validé pour WB et IF.

Aperçu rapide pour ALKBH1 anticorps (ABIN7879953)

Antigène: ALKBH1 (AlkB, Alkylation Repair Homolog 1 (ALKBH1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALKBH1 est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF)

Détail du produit anti-ALKBH1 anticorps

Fonction: ALKBH1 Antibody

Séquence: YLKTARVNMT VRQVLATDQN FPLEPIEDEK RD

Purification: Affinity purified

Immunogène: Amino acids YLKTARVNMTVRQVLATDQNFPLEPIEDEKRD from the human protein were used as the immunogen for the ALKBH1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the ALKBH1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the ALKBH1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur ALKBH1

Antigène: ALKBH1 (AlkB, Alkylation Repair Homolog 1 (ALKBH1))

Autre désignation: ALKBH1

Sujet: Nucleic acid dioxygenase ALKBH1 is an enzyme that in humans is encoded by the ALKBH1 gene. It is mapped to 14q24.3. This gene encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine.

UniProt: Q13686

Pathways: Réparation de l'ADN