SUMO1 anticorps

N° du produit ABIN7882287

Cet anticorps Lapin Polyclonal détecte spécifiquement SUMO1 dans IF, FACS et IHC (p). Il présente une réactivité avec des échantillons de Humain, Rat et Souris.

Aperçu rapide pour SUMO1 anticorps (ABIN7882287)

Antigène: SUMO1 (Small Ubiquitin Related Modifier Protein 1 (SUMO1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SUMO1 est non-conjugé

Application: Immunofluorescence (IF), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-SUMO1 anticorps

Fonction: SUMO1 Antibody

Séquence: HLKKLKESYC QRQGVPMNSL RFLFEGQRIA DNHTPKEL

Purification: Affinity purified

Immunogène: Amino acids HLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKEL from the human protein were used as the immunogen for the SUMO1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the SUMO1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the SUMO1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur SUMO1

Antigène: SUMO1 (Small Ubiquitin Related Modifier Protein 1 (SUMO1))

Autre désignation: SUMO1

Sujet: Small ubiquitin-related modifier 1(SUMO1), also called SMT3C or PIC1 is a protein that in humans is encoded by the SUMO1 gene. This gene is mapped to 2q33.1. This gene encodes a protein that is a member of the SUMO(small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last four amino acids of the carboxy-terminus have been cleaved off. Several pseudogenes have been reported for this gene.

UniProt: P63165

Pathways: M Phase, Positive Regulation of Endopeptidase Activity, Protein targeting to Nucleus, Ubiquitin Proteasome Pathway