RENT1/UPF1 anticorps

N° du produit ABIN7882643

Cet anticorps anti-RENT1/UPF1 Monoclonal Souris (Clone 11E7-) (ABIN7882643) détecte spécifiquement RENT1/UPF1 dans WB, IF et IHC (p). L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour RENT1/UPF1 anticorps (ABIN7882643)

Antigène: RENT1/UPF1 (UPF1) (UPF1 Regulator of Nonsense Transcripts Homolog (UPF1))

Reactivité: Humain, Souris, Rat

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp RENT1/UPF1 est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 11E7-

Détail du produit anti-RENT1/UPF1 anticorps

Fonction: RENT1 Antibody / hUPF1

Séquence: NMDSMPELQK LQQLKDETGE LSSADEKRYR ALKRT

Purification: Affinity purified

Immunogène: Amino acids NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE from the human protein were used as the immunogen for the RENT1 antibody.

Isotype: IgG2b

Information d'application

Indications d'application: Optimal dilution of the RENT1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the RENT1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur RENT1/UPF1

Antigène: RENT1/UPF1 (UPF1) (UPF1 Regulator of Nonsense Transcripts Homolog (UPF1))

Autre désignation: RENT1

Sujet: Regulator of nonsense transcripts 1 is a protein that in humans is encoded by the UPF1 gene. This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. And this protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. Alternative splicing results in multiple transcript variants.

UniProt: Q92900

Pathways: SARS-CoV-2 Protein Interactome