GLI3 anticorps

N° du produit ABIN8101492

Cet anticorps Lapin Polyclonal détecte spécifiquement GLI3 dans IHC. Il présente une réactivité avec des échantillons de Humain, Souris, Rat, Chien, Lapin, Boeuf (Vache), Cheval, Cobaye et Poisson zèbre (Danio rerio).

Aperçu rapide pour GLI3 anticorps (ABIN8101492)

Antigène: GLI3 (GLI Family Zinc Finger 3 (GLI3))

Reactivité: Humain, Souris, Rat, Chien, Lapin, Boeuf (Vache), Cheval, Cobaye, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GLI3 est non-conjugé

Application: Immunohistochemistry (IHC)

Détail du produit anti-GLI3 anticorps

Fonction: GLI3 Antibody

Séquence: KPDEDLPSPG ARGQQEQPEG TTLVKEEGDK DESKQEPEVI YETNCHWEGC

Homologie: Cow: 100%, Dog: 93%, Guinea Pig: 100%, Horse: 100%, Human: 100%, Mouse: 100%, Rabbit: 100%, Rat: 100%, Zebrafish: 79%

Purification: Affinity Purified

Immunogène: The immunogen is a synthetic peptide directed towards the following sequence KPDEDLPSPGARGQQEQPEGTTLVKEEGDKDESKQEPEVIYETNCHWEGC

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP32317-100UG

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: prevent freeze-thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Détails sur GLI3

Antigène: GLI3 (GLI Family Zinc Finger 3 (GLI3))

Autre désignation: GLI3

Sujet:

Background Information: This gene encodes a protein which belongs to the C2H2-type zinc finger proteins subclass of the Gli family. They are characterized as DNA-binding transcription factors and are mediators of Sonic hedgehog (Shh) signaling. The protein encoded by this gene localizes in the cytoplasm and activates patched Drosophila homolog (PTCH) gene expression. It is also thought to play a role during embryogenesis. Mutations in this gene have been associated with several diseases, including Greig cephalopolysyndactyly syndrome, Pallister-Hall syndrome, preaxial polydactyly type IV, and postaxial polydactyly types A1 and B.

Gene Name: GLI family zinc finger 3

Alternative Symbols: PHS, ACLS, GCPS, PAPA, PAPB, PAP-A, PAPA1, PPDIV, GLI3FL, GLI3-190

Protein Name: Transcriptional activator GLI3

Poids moléculaire: 170 kDa

ID gène: 2737

NCBI Accession: NP_000159

UniProt: P10071

Pathways: Signalisation Hedgehog