LGR5 anticorps (Middle Region)

N° du produit ABIN8104343

L’anticorps anti-LGR5 Polyclonal Lapin est utilisé pour la détection de LGR5 dans des échantillons de Humain, Souris, Rat, Boeuf (Vache), Cheval, Porc et Lapin. Il a été validé pour IHC.

Aperçu rapide pour LGR5 anticorps (Middle Region) (ABIN8104343)

Antigène: LGR5 (Leucine-Rich Repeat Containing G Protein-Coupled Receptor 5 (LGR5))

Reactivité: Humain, Souris, Rat, Boeuf (Vache), Cheval, Porc, Lapin

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LGR5 est non-conjugé

Application: Immunohistochemistry (IHC)

Détail du produit anti-LGR5 anticorps

Épitope: Middle Region

Fonction: LGR5 Antibody - middle region

Séquence: KKDAGMFQAQ DERDLEDFLL DFEEDLKALH SVQCSPSPGP FKPCEHLLDG

Homologie: Cow: 93%, Horse: 92%, Human: 100%, Mouse: 93%, Pig: 77%, Rabbit: 93%, Rat: 93%

Purification: Affinity Purified

Immunogène: The immunogen is a synthetic peptide directed towards the following sequence KKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP59640-100UG

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: prevent freeze-thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Détails sur LGR5

Antigène: LGR5 (Leucine-Rich Repeat Containing G Protein-Coupled Receptor 5 (LGR5))

Autre désignation: LGR5

Sujet:

Gene Name: leucine-rich repeat containing G protein-coupled receptor 5

Alternative Symbols: FEX, HG38, GPR49, GPR67, GRP49

Protein Name: Leucine-rich repeat-containing G-protein coupled receptor 5

Poids moléculaire: 100 kDa

ID gène: 8549

NCBI Accession: NP_003658

UniProt: O75473

Pathways: Signalisation WNT