NOX3 anticorps

N° du produit ABIN8106196

Cet anticorps Lapin Polyclonal détecte spécifiquement NOX3 dans IHC. Il présente une réactivité avec des échantillons de Humain, Souris, Rat, Boeuf (Vache), Chien, Cobaye, Cheval, Porc et Lapin.

Aperçu rapide pour NOX3 anticorps (ABIN8106196)

Antigène: NOX3 (NADPH Oxidase 3 (NOX3))

Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cobaye, Cheval, Porc, Lapin

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NOX3 est non-conjugé

Application: Immunohistochemistry (IHC)

Détail du produit anti-NOX3 anticorps

Fonction: NOX3 Antibody

Séquence: KQIAYNHPSS SIGVFFCGPK ALSRTLQKMC HLYSSADPRG VHFYYNKESF

Homologie: Cow: 100%, Dog: 100%, Guinea Pig: 93%, Horse: 100%, Human: 100%, Mouse: 92%, Pig: 100%, Rabbit: 100%, Rat: 92%

Purification: Affinity Purified

Immunogène: The immunogen is a synthetic peptide directed towards the following sequence KQIAYNHPSSSIGVFFCGPKALSRTLQKMCHLYSSADPRGVHFYYNKESF

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP47185-100UG

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: prevent freeze-thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Détails sur NOX3

Antigène: NOX3 (NADPH Oxidase 3 (NOX3))

Autre désignation: NOX3

Sujet:

Background Information: This gene encodes a member of the NOX family of NADPH oxidases. These enzymes have the capacity to generate superoxide and other reactive oxygen species (ROS) and transport electrons across the plasma membrane. The ROS generated by family members have been implicated in numerous biological functions including host defense, posttranlational processing of proteins, cellular signaling, regulation of gene expression, and cell differentiation. The protein encoded by this gene is expressed predominantly in the inner ear and is involved in the biogenesis of otoconia/otolith, which are crystalline structures of the inner ear involved in the perception of gravity.

Gene Name: NADPH oxidase 3

Alternative Symbols: MOX-2, GP91-3

Protein Name: NADPH oxidase 3

Poids moléculaire: 65 kDa

ID gène: 50508

NCBI Accession: NP_056533

UniProt: Q9HBY0