HSPE1 anticorps
Aperçu rapide pour HSPE1 anticorps (ABIN632792)
Antigène
Voir toutes HSPE1 AnticorpsReactivité
Hôte
Clonalité
Conjugué
Application
-
-
Purification
- Affinity purified
-
Immunogène
- HSPE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
-
-
anti-Heat Shock 10kDa Protein 1 (Chaperonin 10) (HSPE1) antibody
HSPE1 Reactivité: Humain WB, IHC, IF Hôte: Lapin Monoclonal unconjugated
anti-Heat Shock 10kDa Protein 1 (Chaperonin 10) (HSPE1) (AA 1-102) antibodyHSPE1 Reactivité: Humain WB, ELISA, IF Hôte: Souris Monoclonal 4C11-B11 unconjugated
anti-Heat Shock 10kDa Protein 1 (Chaperonin 10) (HSPE1) (AA 51-102) antibodyHSPE1 Reactivité: Humain ELISA, IHC (p), IF (p), IF (cc), IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-Heat Shock 10kDa Protein 1 (Chaperonin 10) (HSPE1) (AA 81-102), (C-Term) antibodyHSPE1 Reactivité: Humain, Souris, Rat WB, IHC, IF, ICC, FACS Hôte: Lapin Polyclonal unconjugated
anti-Heat Shock 10kDa Protein 1 (Chaperonin 10) (HSPE1) (AA 2-102) antibodyHSPE1 Reactivité: Souris WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Heat Shock 10kDa Protein 1 (Chaperonin 10) (HSPE1) (Internal Region) antibodyHSPE1 Reactivité: Humain, Souris, Rat WB, IHC, ELISA, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-Heat Shock 10kDa Protein 1 (Chaperonin 10) (HSPE1) (AA 91-101) antibody (Atto 390)HSPE1 Reactivité: Humain WB, IHC, ELISA, IF, IP, ICC Hôte: Lapin Polyclonal Atto 390
anti-Heat Shock 10kDa Protein 1 (Chaperonin 10) (HSPE1) (AA 91-101) antibody (Atto 488)HSPE1 Reactivité: Humain WB, IHC, ELISA, IF, IP, ICC Hôte: Lapin Polyclonal Atto 488
anti-Heat Shock 10kDa Protein 1 (Chaperonin 10) (HSPE1) (AA 91-101) antibody (APC)HSPE1 Reactivité: Humain WB, IHC, ELISA, IF, IP, ICC Hôte: Lapin Polyclonal APC
anti-Heat Shock 10kDa Protein 1 (Chaperonin 10) (HSPE1) (AA 91-101) antibody (Biotin)HSPE1 Reactivité: Humain WB, IHC, ELISA, IF, IP, ICC Hôte: Lapin Polyclonal Biotin
-
-
Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Commentaires
-
HSPE1 Blocking Peptide, (ABIN938746), is also available for use as a blocking control in assays to test for specificity of this HSPE1 antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPE1 antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
-
Stock
- 4 °C/-20 °C
-
Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- HSPE1 (Heat Shock 10kDa Protein 1 (Chaperonin 10) (HSPE1))
-
Autre désignation
- HSPE1
-
Sujet
- HSPE1 is a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner.
-
Poids moléculaire
- 11 kDa (MW of target protein)
-
Pathways
- Positive Regulation of Endopeptidase Activity
Antigène
-
