ADAM28 anticorps (N-Term)
-
- Antigène Voir toutes ADAM28 Anticorps
- ADAM28 (ADAM Metallopeptidase Domain 28 (ADAM28))
-
Épitope
- AA 207-248, N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ADAM28 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Disintegrin and metalloproteinase domain-containing protein 28(ADAM28) detection. Tested with WB in Human.
- Séquence
- EYYLVLDNGE FKRYNENQDE IRKRVFEMAN YVNMLYKKLN TH
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Disintegrin and metalloproteinase domain-containing protein 28(ADAM28) detection. Tested with WB in Human.
Gene Name: ADAM metallopeptidase domain 28
Protein Name: Disintegrin and metalloproteinase domain-containing protein 28 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human ADAM28 (207-248aa EYYLVLDNGEFKRYNENQDEIRKRVFEMANYVNMLYKKLNTH), different from the related mouse sequence by eleven amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product ADAM28 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- ADAM28 (ADAM Metallopeptidase Domain 28 (ADAM28))
- Autre désignation
- ADAM28 (ADAM28 Produits)
- Synonymes
- anticorps C130072N01Rik, anticorps D430033C21Rik, anticorps Dtgn1, anticorps MDC-L, anticorps MDC-Lm, anticorps MDC-Ls, anticorps MDCL, anticorps TECADAM, anticorps eMDCII, anticorps ADAM 28, anticorps ADAM23, anticorps eMDC II, anticorps ADAM metallopeptidase domain 28, anticorps a disintegrin and metallopeptidase domain 28, anticorps Adam28, anticorps ADAM28
- Sujet
-
Disintegrin and metalloproteinase domain-containing protein 28 is an enzyme that in humans is encoded by the ADAM28 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is a lymphocyte-expressed ADAM protein. And this gene is present in a gene cluster with other members of the ADAM family on chromosome 8. Alternative splicing results in multiple transcript variants.
Synonyms: ADAM28 | ADAM 28 | ADAM23 | eMDC II | eMDCII | MDC L | MDCL | Q9UKQ2 - ID gène
- 10863
-