PDXP anticorps
-
- Antigène Voir toutes PDXP Anticorps
- PDXP (Pyridoxal (Pyridoxine, Vitamin B6) Phosphatase (PDXP))
-
Reactivité
- Souris, Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PDXP est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PDXP antibody was raised using a synthetic peptide corresponding to a region with amino acids DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSI
- Top Product
- Discover our top product PDXP Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PDXP Blocking Peptide, catalog no. 33R-2122, is also available for use as a blocking control in assays to test for specificity of this PDXP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDXP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PDXP (Pyridoxal (Pyridoxine, Vitamin B6) Phosphatase (PDXP))
- Autre désignation
- PDXP (PDXP Produits)
- Synonymes
- anticorps CIN, anticorps PLP, anticorps dJ37E16.5, anticorps 1600027H05Rik, anticorps AB041662, anticorps PLPP, anticorps Rbp1, anticorps pyridoxal phosphatase, anticorps pyridoxal (pyridoxine, vitamin B6) phosphatase, anticorps PDXP, anticorps Pdxp
- Sujet
- Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP.
- Poids moléculaire
- 32 kDa (MW of target protein)
-