ST8SIA4 anticorps (Middle Region)
-
- Antigène Voir toutes ST8SIA4 Anticorps
- ST8SIA4 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 4 (ST8SIA4))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ST8SIA4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ST8 SIA4 antibody was raised against the middle region of ST8 IA4
- Purification
- Affinity purified
- Immunogène
- ST8 SIA4 antibody was raised using the middle region of ST8 IA4 corresponding to a region with amino acids DVGTKSDFITMNPSVVQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFM
- Top Product
- Discover our top product ST8SIA4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ST8SIA4 Blocking Peptide, catalog no. 33R-2214, is also available for use as a blocking control in assays to test for specificity of this ST8SIA4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 IA4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ST8SIA4 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 4 (ST8SIA4))
- Autre désignation
- ST8SIA4 (ST8SIA4 Produits)
- Synonymes
- anticorps PST, anticorps PST-1, anticorps SIAT8-D, anticorps ST8SiaIV, anticorps Siat8d, anticorps PST1, anticorps SIAT8D, anticorps ST8SIA-IV, anticorps ST8Sia-IV, anticorps pst, anticorps siat 8D, anticorps ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4, anticorps St8sia4, anticorps ST8SIA4, anticorps st8sia4
- Sujet
- ST8SIA4 catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). ST8SIA4, a member of glycosyltransferase family 29, is a type II membrane protein that may be present in the Golgi apparatus.
- Poids moléculaire
- 41 kDa (MW of target protein)
-