MAP4K5 anticorps (Middle Region)
-
- Antigène Voir toutes MAP4K5 Anticorps
- MAP4K5 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 5 (MAP4K5))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MAP4K5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MAP4 K5 antibody was raised against the middle region of MAP4 5
- Purification
- Affinity purified
- Immunogène
- MAP4 K5 antibody was raised using the middle region of MAP4 5 corresponding to a region with amino acids QGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILA
- Top Product
- Discover our top product MAP4K5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MAP4K5 Blocking Peptide, catalog no. 33R-7562, is also available for use as a blocking control in assays to test for specificity of this MAP4K5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MAP4K5 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 5 (MAP4K5))
- Autre désignation
- MAP4K5 (MAP4K5 Produits)
- Synonymes
- anticorps GCKR, anticorps KHS, anticorps KHS1, anticorps MAPKKKK5, anticorps 4432415E19Rik, anticorps RGD1562028, anticorps fl74c10, anticorps wu:fl74c10, anticorps zgc:55719, anticorps zgc:55985, anticorps mitogen-activated protein kinase kinase kinase kinase 5, anticorps mitogen-activated protein kinase kinase kinase kinase 5 S homeolog, anticorps MAP4K5, anticorps Map4k5, anticorps map4k5, anticorps map4k5.S
- Sujet
- MAP4K5 may play a role in the response to environmental stress. Appears to act upstream of the JUN N-terminal pathway.
- Poids moléculaire
- 95 kDa (MW of target protein)
-