anti-Humain FHOD3 anticorps pour Immunocytochemistry

Recommended FHOD3 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Formin Homology 2 Domain Containing 3 (FHOD3) Anticorps
  • FHOS2
  • Formactin2
  • A930009H06Rik
  • mKIAA1695
  • formin homology 2 domain containing 3b
  • formin homology 2 domain containing 3
  • fhod3b
  • FHOD3
  • Fhod3
Reactivité
Humain
8
3
3
3
3
3
3
Hôte
Lapin
8
Clonalité
Polyclonal
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
6
3
1
Fournisseur
Connectez-vous pour afficher
Supplier Product No.
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4311639
Produit non disponible pour cette région.

General

Antigène Formin Homology 2 Domain Containing 3 (FHOD3) Anticorps
Reactivité Humain
(8), (3), (3), (3), (3), (3), (3)
Hôte Lapin
(8)
Clonalité
Polyclonal
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(6), (3), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-FHOD3 anticorps

Détail du antigène FHOD3 Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:GVDTELLVYAMTLVNKTLSGLPDQDTFYDVVDCLEELGIAAVSQRHLNKKGTDLDLVEQLNIYEVALRHEDGDETTEPPPSGCRDRRRASVCSSGGGEHRGLDRRRSRRHSVQSIKSTLSAPTSPCSQSAPSFKPNQV
Isotype IgG

Détail du antigène FHOD3

Détail du produit anti-FHOD3 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation FHOD3 (FHOD3 Antibody Extrait)
Sujet Gene Symbol: FHOD3
ID gène 80206
Pathways Regulation of Actin Filament Polymerization

Information d'application

Détail du produit anti-FHOD3 anticorps Détail du antigène FHOD3 Stockage Images Haut de la page
Indications d'application Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-FHOD3 anticorps Détail du antigène FHOD3 Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit anti-FHOD3 anticorps Détail du antigène FHOD3 Information d'application Stockage Haut de la page
Supplier Images
Immunofluorescence (IF) image for anti-Formin Homology 2 Domain Containing 3 (FHOD3) antibody (ABIN4311639) Immunocytochemistry/Immunofluorescence: FHOD3 Antibody [NBP1-83898] - Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Formin Homology 2 Domain Containing 3 (FHOD3) antibody (ABIN4311639) Immunohistochemistry-Paraffin: FHOD3 Antibody [NBP1-83898] Staining of human cerebral...