AIF anticorps (AA 151-180)

N° du produit ABIN1099879

Cet anticorps Lapin Polyclonal détecte spécifiquement AIF dans WB, IHC et IHC (p). Il présente une réactivité envers Humain, Rat et Souris.

Aperçu rapide pour AIF anticorps (AA 151-180) (ABIN1099879)

Antigène: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AIF est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-AIF anticorps

Épitope: AA 151-180

Marque: IHC-plus™

Purification: Affinity purified

Immunogène: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) conjugated to BSA

Isotype: IgG

Information d'application

Indications d'application: Approved: IHC, IHC-P (5 μg/mL), WB

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: TBS containing 50 % glycerol, 0.5 mg/mL BSA, and 0.02 % sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: avoid freeze thaw cycles.

Stock: 4 °C,-20 °C

Stockage commentaire: Short term 4°C, long term aliquot and store at -20°C, avoid freeze-thaw cycles.

Détails sur AIF

Antigène: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Autre désignation: AIFM1 / AIF / PDCD8

Sujet: Name/Gene ID: AIFM1
Family: Apoptosis

Synonyms: AIFM1, AIF, COXPD6, PDCD8, Programmed cell death 8

ID gène: 9131

UniProt: O95831

Pathways: Apoptose, Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis, Smooth Muscle Cell Migration, L'effet Warburg