TLR8 anticorps (N-Term)

N° du produit ABIN2153307

Cet anticorps anti-TLR8 Polyclonal Chèvre (ABIN2153307) détecte spécifiquement TLR8 dans WB et IHC. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour TLR8 anticorps (N-Term) (ABIN2153307)

Antigène: TLR8 (Toll-Like Receptor 8 (TLR8))

Reactivité: Humain

Hôte: Chèvre

Clonalité: Polyclonal

Conjugué: Cet anticorp TLR8 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-TLR8 anticorps

Épitope: AA 81-109, N-Term

Purification: TLR8 antibody was purified by affinity chromatography

Immunogène: TLR8 antibody was raised in Goat using 30 amino acid (aa)synthetic peptide CESFQGLQNLTKINLNHNPNVQHQNGNPGI corresponding to aa 81-109 of the N-terminal domain of Human TLR8 as the immunogen

Information d'application

Indications d'application: IHC: 1:125, WB: 1:500

Restrictions: For Research Use only

Stockage

Concentration: Lot specific

Buffer: 10 mM KHPO4, 140 mM NaCl with 0.1 % sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles

Stock: -20 °C

Stockage commentaire: Aliquot and freeze at -20 °C

Détails sur TLR8

Antigène: TLR8 (Toll-Like Receptor 8 (TLR8))

Autre désignation: TLR8

Pathways: Signalisation TLR, Activation of Innate immune Response, Toll-Like Receptors Cascades