VEGFA anticorps

N° du produit ABIN2629817

Détail du produit anti-VEGFA anticorps

Antigène: VEGFA (Vascular Endothelial Growth Factor A (VEGFA))

Reactivité: Humain, Rat, Souris, Porc, Chien, Lapin, Poulet, Boeuf (Vache), Mouton, Cobaye, Cheval, Singe, Cat, Âne, Chévre, Hamster

Hôte: Chèvre

Clonalité: Polyclonal

Conjugué: Cet anticorp VEGFA est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF)

Specificité: Detects endogenous levels of total VEGFA by Western blot in whole cell and tissue lysates.

Purification: Immunoaffinity purified

Immunogène: Purified recombinant human VEGFA isoform 6 produced in E. coli. corresponding to P15692-6 (MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD)

Isotype: IgG

Information d'application

Indications d'application: Approved: IF (1:50 - 1:250), WB (1:500 - 1:2000)

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: PBS, 20 % glycerol, 0.05 % sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C,-20 °C

Stockage commentaire: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Détails sur VEGFA

Antigène: VEGFA (Vascular Endothelial Growth Factor A (VEGFA))

Autre désignation: VEGFA / VEGF (VEGFA Produits)

Synonymes: anticorps MVCD1, anticorps VEGF, anticorps VPF, anticorps Vegf, anticorps Vegf120, anticorps Vegf164, anticorps Vegf188, anticorps Vpf, anticorps vegf, anticorps vegfa, anticorps wu:fj82c06, anticorps VEGF-A, anticorps VEGF164, anticorps eVEGF120, anticorps eVEGF164, anticorps vegf-a, anticorps vpf, anticorps vefg, anticorps si:dkey-14d8.3, anticorps wu:fd42e02, anticorps vascular endothelial growth factor A, anticorps vascular endothelial growth factor Aa, anticorps vascular endothelial growth factor A L homeolog, anticorps vascular endothelial growth factor Ab, anticorps VEGFA, anticorps Vegfa, anticorps vegfaa, anticorps vegfa.L, anticorps vegfa, anticorps vegfab

Sujet: Name/Gene ID: VEGFA
Family: PDGF

Synonyms: VEGFA, VPF, Vascular permeability factor, VEGF, VEGF-A, MVCD1

ID gène: 7422

UniProt: P15692

Pathways: Signalisation RTK, Glycosaminoglycan Metabolic Process, Regulation of Cell Size, Tube Formation, Signaling Events mediated by VEGFR1 and VEGFR2, Platelet-derived growth Factor Receptor Signaling, VEGFR1 Specific Signals, VEGF Signaling