AIF anticorps (AA 582-613)

N° du produit ABIN2738204

Cet anticorps Lapin Polyclonal détecte spécifiquement AIF dans WB, IHC et IHC (p). Il présente une réactivité avec des échantillons de Humain, Rat, Souris, Porc, Boeuf (Vache), Cheval, Lapin, Singe, Hamster, Roussette (Chauve-souris) et Gibbon.

Aperçu rapide pour AIF anticorps (AA 582-613) (ABIN2738204)

Antigène: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Reactivité: Humain, Rat, Souris, Porc, Boeuf (Vache), Cheval, Lapin, Singe, Hamster, Roussette (Chauve-souris), Gibbon

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AIF est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-AIF anticorps

Épitope: AA 582-613

Specificité: Detected in muscle and skin fibroblasts (at protein level). Isoform 5 is frequently down-regulated in human cancers. .

Purification: Immunogen affinity purified

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human AIF(582-613aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: avoid freeze thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Détails sur AIF

Antigène: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Autre désignation: AIFM1 / AIF / PDCD8

Sujet: Name/Gene ID: AIFM1
Family: Apoptosis

Synonyms: AIFM1, AIF, COXPD6, PDCD8, Programmed cell death 8

ID gène: 9131

Pathways: Apoptose, Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis, Smooth Muscle Cell Migration, L'effet Warburg