ING1 anticorps (Middle Region)

N° du produit ABIN3042467

Détail du produit anti-ING1 anticorps

Antigène: ING1 (Inhibitor of Growth Family, Member 1 (ING1))

Épitope: AA 192-223, Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ING1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Inhibitor of growth protein 1(ING1) detection. Tested with WB in Human.

Séquence: KELDECYERF SRETDGAQKR RMLHCVQRAL IR

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Inhibitor of growth protein 1(ING1) detection. Tested with WB in Human.
Gene Name: inhibitor of growth family, member 1
Protein Name: Inhibitor of growth protein 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human ING1 (192-223aa KELDECYERFSRETDGAQKRRMLHCVQRALIR), different from the related mouse sequence by seven amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur ING1

Antigène: ING1 (Inhibitor of Growth Family, Member 1 (ING1))

Autre désignation: ING1 (ING1 Produits)

Synonymes: anticorps p24ING1c, anticorps p33, anticorps p33ING1, anticorps p33ING1b, anticorps p47, anticorps p47ING1a, anticorps p33ING1c, anticorps zgc:136918, anticorps ING1, anticorps 2610028J21Rik, anticorps AA407184, anticorps AI875420, anticorps mING1h, anticorps p33Ing1, anticorps p37Ing1b, anticorps xing1, anticorps inhibitor of growth family member 1, anticorps inhibitor of growth family, member 1, anticorps inhibitor of growth family member 1 S homeolog, anticorps ING1, anticorps Ing1, anticorps ing1, anticorps ing1.S

Sujet: Inhibitor of growth protein 1 is a protein that in humans is encoded by the ING1 gene. It is mapped to 13q34. This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.

Synonyms: 2610028J21Rik antibody|AA407184 antibody|AI875420 antibody|Growth inhibitor ING 1 antibody|Growth inhibitor ING1 antibody|Growth inhibitory protein ING 1 antibody|Growth inhibitory protein ING1 antibody|Homo sapiens growth inhibitor p33ING1 (ING1) mRNA, complete cds antibody|ING 1 antibody|Ing1 antibody|ING1_HUMAN antibody|Inhibitor of growth 1 antibody|Inhibitor of growth family member 1 antibody|Inhibitor of growth protein 1 antibody|mING1h antibody|OTTHUMP00000018703 antibody|OTTHUMP00000018704 antibody| OTTHUMP00000018705 antibody|OTTHUMP00000018706 antibody|p24ING1c antibody|p33 antibody|p33 ING1 antibody|p33ING1 antibody|p33ING1b antibody|p33ING1c antibody|p37Ing1b antibody|p47 antibody|p47ING1a antibody|Tumor suppressor ING 1 antibody|Tumor suppressor ING1 antibody

ID gène: 3621

Pathways: Protein targeting to Nucleus, Autophagy