HTR2A anticorps (C-Term)
-
- Antigène Voir toutes HTR2A Anticorps
- HTR2A (5-Hydroxytryptamine (serotonin) Receptor 2A (HTR2A))
-
Épitope
- AA 400-431, C-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HTR2A est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for 5-hydroxytryptamine receptor 2A(HTR2A) detection. Tested with WB in Human,Rat.
- Séquence
- KENKKPLQLI LVNTIPALAY KSSQLQMGQK KN
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for 5-hydroxytryptamine receptor 2A(HTR2A) detection. Tested with WB in Human,Rat.
Gene Name: 5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled
Protein Name: 5-hydroxytryptamine receptor 2A - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) , different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product HTR2A Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- HTR2A (5-Hydroxytryptamine (serotonin) Receptor 2A (HTR2A))
- Autre désignation
- HTR2A (HTR2A Produits)
- Synonymes
- anticorps 5-HT2A, anticorps HTR2, anticorps 5-HT-2, anticorps 5-HT-2A, anticorps 5-HTR2A, anticorps LOC100009461, anticorps E030013E04, anticorps Htr-2, anticorps Htr2, anticorps 5Ht-2, anticorps 5HT2A, anticorps 5HTR2A, anticorps HTR2A, anticorps Htr2a, anticorps 5HT2, anticorps 5-hydroxytryptamine receptor 2A, anticorps 5-hydroxytryptamine (serotonin) receptor 2A, anticorps HTR2A, anticorps Htr2a
- Sujet
-
The mammalian HTR2A (5-HT2A receptor) is a subtype of the 5-HT2 receptor that belongs to the serotonin receptor family and is a G protein-coupled receptor (GPCR). This is the main excitatory receptor subtype among the GPCRs for serotonin (5-HT), although 5-HT2A may also have an inhibitory effect on certain areas such as the visual cortex and the orbit frontal cortex. This receptor was given importance first as the target of psychedelic drugs like LSD. Later it came back to prominence because it was also found to be mediating, at least partly, the action of many antipsychotic drugs, especially the atypical ones. 5-HT2A also happens to be a necessary receptor for the spread of the human polyoma virus called JC virus. Sparkes et al. (1991) concluded that the gene is located on 13q14-q21 in man and on chromosome 14 in the mouse.
Synonyms: 5 HT 2 antibody|5 HT 2A antibody|5 HT2 receptor antibody|5 HT2A antibody|5 hydroxytryptamine receptor 2A antibody|5-HT-2 antibody|5-HT-2A antibody|5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled antibody|5-hydroxytryptamine 2A receptor antibody|5-hydroxytryptamine receptor 2A antibody|5HT2A_HUMAN antibody|HTR 2 antibody|HTR 2A antibody|HTR2 antibody|HTR2, formerly antibody|HTR2A antibody|serotonin 5-HT-2 receptor, formerly antibody|serotonin 5-HT-2A receptor antibody|Serotonin receptor 2A antibody - ID gène
- 3356
- UniProt
- P28223
- Pathways
- Signalistation JAK/STAT, Inositol Metabolic Process, Regulation of Carbohydrate Metabolic Process
-