Integrin Alpha2b anticorps (C-Term)

N° du produit ABIN3043254

Détail du produit anti-Integrin Alpha2b anticorps

Antigène: Integrin Alpha2b (CD41)

Épitope: AA 677-711, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Integrin Alpha2b est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Integrin alpha-Iib(ITGA2B) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: EAELAVHLPQ GAHYMRALSN VEGFERLICN QKKEN

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Integrin alpha-Iib(ITGA2B) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)
Protein Name: Integrin alpha-Iib

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human ITGA2B (677-711aa EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN), different from the related mouse sequence by four amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur Integrin Alpha2b

Antigène: Integrin Alpha2b (CD41)

Autre désignation: ITGA2B (CD41 Produits)

Synonymes: anticorps AI172977, anticorps CD41, anticorps CD41B, anticorps GpIIb, anticorps alphaIIb, anticorps BDPLT16, anticorps BDPLT2, anticorps GP2B, anticorps GPIIb, anticorps GT, anticorps GTA, anticorps HPA3, anticorps integrin alpha 2b, anticorps integrin subunit alpha 2b, anticorps Itga2b, anticorps ITGA2B

Sujet: Integrin alpha-IIb is a protein that in humans is encoded by the ITGA2B gene. It is mapped to 17q21.32. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 2b undergoes post-translational cleavage to yield disulfide-linked light and heavy chains that join with beta 3 to form a fibrinogen receptor expressed in platelets that plays a crucial role in coagulation. Mutations that interfere with this role result in thrombasthenia. In addition to adhesion, integrins are known to participate in cell-surface mediated signalling.

Synonyms: antigen CD41 antibody|BDPLT16 antibody|BDPLT2 antibody|CD41 antibody|CD41B antibody|form 2 antibody|GP2B antibody|GPalpha IIb antibody|GPIIb antibody|GT antibody|GTA antibody|HPA3 antibody|Integrin alpha 2b antibody|Integrin alpha IIb antibody|Integrin alpha-IIb light chain antibody|Integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) antibody|ITA2B_HUMAN antibody|ITGA2B antibody|ITGAB antibody|platelet fibrinogen receptor, alpha subunit antibody|platelet glycoprotein IIb of IIb/IIIa complex antibody|Platelet membrane glycoprotein IIb antibody|platelet specific antigen BAK antibody

ID gène: 3674

UniProt: P08514

Pathways: Integrin Complex