NDRG2 anticorps (C-Term)

N° du produit ABIN3043261

Détail du produit anti-NDRG2 anticorps

Antigène: NDRG2 (NDRG Family Member 2 (NDRG2))

Épitope: AA 210-247, C-Term

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NDRG2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Protein NDRG2(NDRG2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: NSELIQKYRN IITHAPNLDN IELYWNSYNN RRDLNFER

Réactivité croisée (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Attributs du produit: Rabbit IgG polyclonal antibody for Protein NDRG2(NDRG2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: NDRG family member 2
Protein Name: Protein NDRG2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human NDRG2 (210-247aa NSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFER), different from the related mouse and rat sequences by three amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-NDRG2 (ABIN3043261)

Sun, Shen, Sun, Tong, Sun, Han, Yang, Zhang, Cao, Yao, Wang: "Variation of NDRG2 and c-Myc expression in rat heart during the acute stage of ischemia/reperfusion injury." dans: Histochemistry and cell biology, Vol. 135, Issue 1, pp. 27-35, (2011) (PubMed).

Détails sur NDRG2

Antigène: NDRG2 (NDRG Family Member 2 (NDRG2))

Autre désignation: NDRG2 (NDRG2 Produits)

Synonymes: anticorps NDRG2, anticorps AI182517, anticorps AU040374, anticorps Ndr2, anticorps SYLD, anticorps im:6909381, anticorps si:dkey-88n24.1, anticorps zgc:101847, anticorps NDRG family member 2, anticorps N-myc downstream regulated gene 2, anticorps NDRG family member 2 S homeolog, anticorps ndrg2, anticorps NDRG2, anticorps Ndrg2, anticorps ndrg2.S

Sujet: Protein NDRG2, also known as KIAA1248, is a protein that in humans is encoded by the NDRG2 gene. It is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. This gene is mapped to 14q11.2. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. It contributes to the regulation of the WNT signaling pathway. Also, this gene may be involved in dendritic cell and neuron differentiation.

Synonyms: Antidepressant related protein ADRG123 antibody|Cytoplasmic protein Ndr1 antibody|DKFZp781G1938 antibody|FLJ25522 antibody|KIAA1248 antibody|N myc downstream regulated gene 2 antibody|N myc downstream regulator 2 antibody|NDR1 related protein NDR2 antibody|NDRG 2 antibody|NDRG family member 2 antibody|NDRG1 related protein antibody|NDRG2 antibody|NDRG2_HUMAN antibody|Protein NDRG2 antibody| Protein Syld709613 antibody|SYLD antibody|Syld709613 protein antibody

ID gène: 57447