Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

TGFBR1 anticorps (N-Term)

TGFBR1 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3043310
  • Antigène Voir toutes TGFBR1 Anticorps
    TGFBR1 (Transforming Growth Factor, beta Receptor 1 (TGFBR1))
    Épitope
    • 9
    • 9
    • 8
    • 8
    • 7
    • 6
    • 5
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 149-186, N-Term
    Reactivité
    • 52
    • 49
    • 24
    • 1
    • 1
    Humain
    Hôte
    • 64
    • 3
    • 2
    • 2
    Lapin
    Clonalité
    • 67
    • 4
    Polyclonal
    Conjugué
    • 41
    • 7
    • 5
    • 5
    • 4
    • 3
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp TGFBR1 est non-conjugé
    Application
    • 55
    • 42
    • 21
    • 10
    • 5
    • 4
    • 3
    • 3
    • 2
    • 1
    • 1
    Western Blotting (WB)
    Fonction
    Rabbit IgG polyclonal antibody for TGF-beta receptor type-1(TGFBR1) detection. Tested with WB in Human.
    Séquence
    HNRTVIHHRV PNEEDPSLDR PFISEGTTLK DLIYDMTT
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for TGF-beta receptor type-1(TGFBR1) detection. Tested with WB in Human.
    Gene Name: transforming growth factor, beta receptor 1
    Protein Name: TGF-beta receptor type-1
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR1 (149-186aa HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT), identical to the related mouse and rat sequences.
    Isotype
    IgG
    Top Product
    Discover our top product TGFBR1 Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
    Notes: Tested Species: Species with positive results.
    Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Wang, Qin, Deng, Yao: "Different localization and expression of protein kinase C-beta in kidney cortex of diabetic nephropathy mice and its role in telmisartan treatment." dans: American journal of translational research, Vol. 7, Issue 6, pp. 1116-25, (2015) (PubMed).

    Li, Yang: "[Effect of interferon-α on rat liver fibrosis induced by CCl(4)]." dans: Zhong nan da xue xue bao. Yi xue ban = Journal of Central South University. Medical sciences, Vol. 36, Issue 3, pp. 243-8, (2012) (PubMed).

    Wei, Lu, Li, Zhan, Wang, Huang: "The expression of AT1 receptor on hepatic stellate cells in rat fibrosis induced by CCl4." dans: Chinese medical journal, Vol. 114, Issue 6, pp. 583-7, (2002) (PubMed).

  • Antigène
    TGFBR1 (Transforming Growth Factor, beta Receptor 1 (TGFBR1))
    Autre désignation
    TGFBR1 (TGFBR1 Produits)
    Synonymes
    anticorps AAT5, anticorps ACVRLK4, anticorps ALK-5, anticorps ALK5, anticorps LDS1A, anticorps LDS2A, anticorps MSSE, anticorps SKR4, anticorps TGFR-1, anticorps aat5, anticorps acvrlk4, anticorps alk-5, anticorps alk5, anticorps lds1a, anticorps lds2a, anticorps skr4, anticorps tgfr-1, anticorps TGFBR1, anticorps x-trr1, anticorps AU017191, anticorps Alk-5, anticorps TbetaR-I, anticorps TbetaRI, anticorps Alk5, anticorps Skr4, anticorps Tgfr-1, anticorps tbetaR-I, anticorps tgfbr1, anticorps zgc:123263, anticorps transforming growth factor beta receptor 1, anticorps transforming growth factor beta receptor I, anticorps transforming growth factor beta receptor I S homeolog, anticorps transforming growth factor, beta receptor I, anticorps transforming growth factor, beta receptor 1, anticorps transforming growth factor, beta receptor 1 a, anticorps TGFBR1, anticorps tgfbr1, anticorps tgfbr1.S, anticorps Tgfbr1, anticorps tgfbr1a
    Sujet
    Transforming growth factor, beta receptor I is a TGF beta receptor. TGFBR1 is its human gene. The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). TGFB1 regulates cell cycle progression by a unique signaling mechanism that involves its binding to TGFBR2 and activation of TGFBR1. Both are transmembrane serine/threonine receptor kinases. The TGFBR1 receptor may be inactivated in many of the cases of human tumor cells refractory to TGFB-mediated cell cycle arrest. Vellucci and Reiss (1997) reported that the TGFBR1 gene is approximately 31 kb long and contains 9 exons. The organization of the segment of the gene that encodes the C-terminal portion of the serine/threonine kinase domain appears to be highly conserved among members of the gene family.

    Synonyms: AAT 5 antibody|AAT5 antibody|Activin A receptor type II like kinase 53 kDa antibody|Activin A receptor type II like kinase, 53kD antibody|Activin A receptor type II like protein kinase of 53kD antibody|activin A receptor type II-like kinase, 53 kDa antibody| activin A receptor type II-like protein kinase of 53kD antibody|Activin receptor like kinase 5 antibody|Activin receptor-like kinase 5 antibody|ACVRLK 4 antibody|ACVRLK4 antibody|ALK 5 antibody|ALK-5 antibody|ALK5 antibody|LDS1A antibody|LDS2A antibody|MSSE antibody| Serine/threonine protein kinase receptor R4 antibody|Serine/threonine-protein kinase receptor R4 antibody|SKR 4 antibody|SKR4 antibody|TbetaR I antibody|TbetaR-I antibody|TGF beta receptor type 1 antibody|TGF beta receptor type I antibody|TGF beta type I receptor antibody|TGF-beta receptor type I antibody|TGF-beta receptor type-1 antibody|TGF-beta type I receptor antibody|TGFBR 1 antibody|TGFBR1 antibody|TGFBR1 protein antibody|TGFR 1 antibody|TGFR-1 antibody|TGFR1 antibody|TGFR1_HUMAN antibody|Transforming growth factor beta receptor 1 antibody|Transforming growth factor beta receptor I (activin A receptor type II like kinase, 53kD) antibody|Transforming growth factor beta receptor I antibody|transforming growth factor, beta receptor 1 antibody|transforming growth factor, beta receptor I (activin A receptor type II-like kinase, 53kD) antibody|Transforming growth factor-beta receptor type I antibody
    ID gène
    7046
    UniProt
    P36897
    Pathways
    Growth Factor Binding
Vous êtes ici:
Support technique