ELAVL4 anticorps (N-Term)

N° du produit ABIN3043372

Détail du produit anti-ELAVL4 anticorps

Antigène: ELAVL4 (ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like 4 (Hu Antigen D) (ELAVL4))

Épitope: AA 8-45, N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ELAVL4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for ELAV-like protein 4(ELAVL4) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: MEPQVSNGPT SNTSNGPSSN NRNCPSPMQT GATTDDSK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for ELAV-like protein 4(ELAVL4) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: ELAV like neuron-specific RNA binding protein 4
Protein Name: ELAV-like protein 4

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human ELAVL4 (8-45aa MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur ELAVL4

Antigène: ELAVL4 (ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like 4 (Hu Antigen D) (ELAVL4))

Autre désignation: ELAVL4 (ELAVL4 Produits)

Synonymes: anticorps HUD, anticorps PNEM, anticorps HuD, anticorps RGD1561943, anticorps r-HuD, anticorps elrd, anticorps hud, anticorps wu:fc24h01, anticorps Elav, anticorps Hud, anticorps elrD, anticorps elrD1, anticorps elrD2, anticorps ELAV-like protein 4, anticorps ELAV like RNA binding protein 4, anticorps ELAV like neuron-specific RNA binding protein 4, anticorps ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D), anticorps ELAV like neuron-specific RNA binding protein 4 L homeolog, anticorps LOC100282339, anticorps LOC100284149, anticorps ELAVL4, anticorps Elavl4, anticorps elavl4, anticorps elavl4.L

Sujet: HuD otherwise known as ELAV-like protein 4 or PNEM is a protein that in humans is encoded by the ELAVL4 gene. This human gene is located at 1p34 by in situ hybridization. The HuD/ELAVL4 protein is an RNA-binding protein. ELAVL4 has specificity for 3-prime uridylate-rich untranslated regions of growth factor mRNAs. And HuD is expressed only in neurons and it binds to AU-rich element-containing mRNAs. As a result of this interaction the, half-life of the transcript is increased. Also, HuD is important in neurons during brain development and plasticity.

Synonyms: ELAV (embryonic lethal abnormal vision Drosophila) like 4 antibody|ELAV L4 antibody|ELAV like 4 antibody|ELAV like protein 4 antibody| ELAV-like protein 4 antibody|ELAV4_HUMAN antibody|Elavl4 antibody|Embryonic lethal abnormal vision Drosophila homolog of like 4 antibody|Hu antigen D antibody|Hu-antigen D antibody|HuD antibody|Paraneoplastic encephalomyelitis antigen HuD antibody|PNEM antibody

ID gène: 1996

UniProt: P26378